Lineage for d1yitx1 (1yit X:7-88)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023152Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1023153Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1023154Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1023155Protein Ribosomal protein L31e [54577] (1 species)
  7. 1023156Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1023174Domain d1yitx1: 1yit X:7-88 [123364]
    Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yity1, d1yitz1
    automatically matched to d1ffku_
    complexed with cd, cl, k, mg, na, vir

Details for d1yitx1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1yitx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yitx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1yitx1:

Click to download the PDB-style file with coordinates for d1yitx1.
(The format of our PDB-style files is described here.)

Timeline for d1yitx1: