| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
| Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
| Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
| Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
| Domain d1yitw1: 1yit W:1-154 [123363] Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitx1, d1yity1, d1yitz1 automatically matched to d1ffkt_ complexed with cd, cl, k, mg, na, vir |
PDB Entry: 1yit (more details), 2.8 Å
SCOPe Domain Sequences for d1yitw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yitw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1yitw1:
View in 3DDomains from other chains: (mouse over for more information) d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitx1, d1yity1, d1yitz1 |