Lineage for d1yitt1 (1yit T:1-119)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784286Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1784287Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1784330Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 1784370Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
    Uniprot P10972
  8. 1784388Domain d1yitt1: 1yit T:1-119 [123360]
    Other proteins in same PDB: d1yit11, d1yit21, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkq_
    complexed with cd, cl, k, mg, na, vir

Details for d1yitt1

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOPe Domain Sequences for d1yitt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yitt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOPe Domain Coordinates for d1yitt1:

Click to download the PDB-style file with coordinates for d1yitt1.
(The format of our PDB-style files is described here.)

Timeline for d1yitt1: