SCOP 1.73: Domain d1yitf1: 1yit F:1-119

Lineage for d1yitf1 (1yit F:1-119)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)

8. Domain d1yitf1: 1yit F:1-119 [123347]
   Other proteins in same PDB: d1yit11, d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
   automatically matched to d1s72f_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yitf1

PDB Entry: 1yit, 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1yitf1:

Sequence; same for both SEQRES and ATOM records:

>d1yitf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d1yitf1:

• d1yitf1 is new in SCOP 1.73
  
• d1yitf1 appears in SCOP 1.75
  
• d1yitf1 appears in the current release, SCOPe 2.08