Lineage for d1yit31 (1yit 3:1-92)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706394Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1706499Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
    automatically mapped to Pfam PF00935
  6. 1706500Protein Ribosomal protein L44e [57837] (1 species)
  7. 1706501Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1706519Domain d1yit31: 1yit 3:1-92 [123339]
    Other proteins in same PDB: d1yit11, d1yit21, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yitg1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkz_
    complexed with cd, cl, k, mg, na, vir

Details for d1yit31

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1yit31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yit31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1yit31:

Click to download the PDB-style file with coordinates for d1yit31.
(The format of our PDB-style files is described here.)

Timeline for d1yit31: