Lineage for d1yit11 (1yit 1:1-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751154Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 751155Protein Ribosomal protein L37e [57834] (1 species)
  7. 751156Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
  8. 751166Domain d1yit11: 1yit 1:1-56 [123338]
    Other proteins in same PDB: d1yit31, d1yita1, d1yita2, d1yitb1, d1yitc1, d1yitd1, d1yite1, d1yite2, d1yitf1, d1yith1, d1yiti1, d1yitj1, d1yitk1, d1yitl1, d1yitm1, d1yitn1, d1yito1, d1yitp1, d1yitq1, d1yitr1, d1yits1, d1yitt1, d1yitu1, d1yitv1, d1yitw1, d1yitx1, d1yity1, d1yitz1
    automatically matched to d1ffkx_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, ur3, vir, vrs

Details for d1yit11

PDB Entry: 1yit (more details), 2.8 Å

PDB Description: Crystal Structure Of Virginiamycin M and S Bound To The 50S Ribosomal Subunit Of Haloarcula Marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1yit11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yit11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1yit11:

Click to download the PDB-style file with coordinates for d1yit11.
(The format of our PDB-style files is described here.)

Timeline for d1yit11: