Lineage for d1yird2 (1yir D:4-144)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. Family d.41.2.2: Monomeric nicotinate phosphoribosyltransferase N-terminal domain-like [110907] (1 protein)
  6. Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (4 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [143199] (1 PDB entry)
    Uniprot Q9HW26 2-142
    NAPRTase 2
  8. Domain d1yird2: 1yir D:4-144 [123337]
    Other proteins in same PDB: d1yira1, d1yira3, d1yirb1, d1yirb3, d1yirc1, d1yirc3, d1yird1, d1yird3
    automated match to d1yira2
    complexed with so4

Details for d1yird2

PDB Entry: 1yir (more details), 2.1 Å

PDB Description: crystal structure of a nicotinate phosphoribosyltransferase
PDB Compounds: (D:) Nicotinate phosphoribosyltransferase 2

SCOPe Domain Sequences for d1yird2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yird2 d.41.2.2 (D:4-144) Nicotinate phosphoribosyltransferase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
aesafserivqnlldtdfykltmmqavlhnypnaevewefrcrnqedlrlylpaireqle
ylaglaisdeqlafleripflapdfirflglfrfnpryvqtgiendefflrlkgpwlhvi
lfevpllamisevrnrarypa

SCOPe Domain Coordinates for d1yird2 are not available.

Timeline for d1yird2:

Domains from same chain:
(mouse over for more information)
d1yird1, d1yird3
Domains from other chains:
(mouse over for more information)
d1yira1, d1yira2, d1yira3, d1yirb1, d1yirb2, d1yirb3, d1yirc1, d1yirc2, d1yirc3