![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein) |
![]() | Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (3 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141863] (1 PDB entry) NAPRTase 2 |
![]() | Domain d1yirc1: 1yir C:145-399 [123334] Other proteins in same PDB: d1yira2, d1yirb2, d1yirc2, d1yird2 automatically matched to 1YIR A:145-399 complexed with so4 |
PDB Entry: 1yir (more details), 2.1 Å
SCOP Domain Sequences for d1yirc1:
Sequence, based on SEQRES records: (download)
>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtpgkaqc rdpdfihylkhvfqv
>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtppdfih ylkhvfqv
Timeline for d1yirc1: