Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins) automatically mapped to Pfam PF04095 |
Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species) |
Species Pseudomonas aeruginosa [TaxId:287] [141863] (1 PDB entry) Uniprot Q9HW26 143-397 NAPRTase 2 |
Domain d1yirc1: 1yir C:145-399 [123334] Other proteins in same PDB: d1yira2, d1yira3, d1yirb2, d1yirb3, d1yirc2, d1yirc3, d1yird2, d1yird3 automated match to d1yira1 complexed with so4 |
PDB Entry: 1yir (more details), 2.1 Å
SCOPe Domain Sequences for d1yirc1:
Sequence, based on SEQRES records: (download)
>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtpgkaqc rdpdfihylkhvfqv
>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtppdfih ylkhvfqv
Timeline for d1yirc1: