Lineage for d1yirc1 (1yir C:145-399)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089241Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2089293Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)
    automatically mapped to Pfam PF04095
  6. 2089294Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (4 species)
  7. 2089308Species Pseudomonas aeruginosa [TaxId:287] [141863] (1 PDB entry)
    Uniprot Q9HW26 143-397
    NAPRTase 2
  8. 2089311Domain d1yirc1: 1yir C:145-399 [123334]
    Other proteins in same PDB: d1yira2, d1yira3, d1yirb2, d1yirb3, d1yirc2, d1yirc3, d1yird2, d1yird3
    automated match to d1yira1
    complexed with so4

Details for d1yirc1

PDB Entry: 1yir (more details), 2.1 Å

PDB Description: Crystal Structure of a Nicotinate Phosphoribosyltransferase
PDB Compounds: (C:) Nicotinate phosphoribosyltransferase 2

SCOPe Domain Sequences for d1yirc1:

Sequence, based on SEQRES records: (download)

>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf
vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd
cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl
pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtpgkaqc
rdpdfihylkhvfqv

Sequence, based on observed residues (ATOM records): (download)

>d1yirc1 c.1.17.2 (C:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf
vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd
cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl
pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtppdfih
ylkhvfqv

SCOPe Domain Coordinates for d1yirc1:

Click to download the PDB-style file with coordinates for d1yirc1.
(The format of our PDB-style files is described here.)

Timeline for d1yirc1: