SCOPe 2.01: Domain d1yirb1: 1yir B:145-399

Lineage for d1yirb1 (1yir B:145-399)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)

6. Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141863] (1 PDB entry)
   Uniprot Q9HW26 143-397
   NAPRTase 2

8. Domain d1yirb1: 1yir B:145-399 [123332]
   Other proteins in same PDB: d1yira2, d1yirb2, d1yirc2, d1yird2
   automatically matched to 1YIR A:145-399
   complexed with so4

Details for d1yirb1

PDB Entry: 1yir, 2.1 Å

PDB Description: crystal structure of a nicotinate phosphoribosyltransferase

PDB Compounds: (B:) Nicotinate phosphoribosyltransferase 2

SCOPe Domain Sequences for d1yirb1:

Sequence, based on SEQRES records:

>d1yirb1 c.1.17.2 (B:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf
vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd
cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl
pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtpgkaqc
rdpdfihylkhvfqv

Sequence, based on observed residues (ATOM records):

>d1yirb1 c.1.17.2 (B:145-399) Nicotinate phosphoribosyltransferase, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
atveqarerlqekfdwlrreasaeelagfkmadfgtrrrfsyrvheavvsglkedfpgcf
vgtsnvhlarkldlkplgtmahewlmahqqlgprlidsqsaaldcwvreyrgllgialtd
cittdaflrdfdlyfaklfdglrhdsgdpllwaektiahylklgidpltktlvfsdgldl
pralkiyralqgrinvsfgigthftcdlpgvepmnivvkmsacnghpvakisdtppdfih
ylkhvfqv

Timeline for d1yirb1:

• d1yirb1 first appeared in SCOP 1.73
  
• d1yirb1 appears in SCOP 1.75
  
• d1yirb1 appears in SCOPe 2.02
  
• d1yirb1 appears in the current release, SCOPe 2.08