Lineage for d1yioa2 (1yio A:3-130)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356044Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1356245Protein Response regulatory protein StyR, N-terminal domain [142027] (1 species)
  7. 1356246Species Pseudomonas fluorescens [TaxId:294] [142028] (2 PDB entries)
    Uniprot O30989 3-130
  8. 1356247Domain d1yioa2: 1yio A:3-130 [123327]
    Other proteins in same PDB: d1yioa1
    complexed with hg, mg

Details for d1yioa2

PDB Entry: 1yio (more details), 2.2 Å

PDB Description: Crystallographic structure of response regulator StyR from Pseudomonas fluorescens
PDB Compounds: (A:) response regulatory protein

SCOPe Domain Sequences for d1yioa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms
gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql
naerrqar

SCOPe Domain Coordinates for d1yioa2:

Click to download the PDB-style file with coordinates for d1yioa2.
(The format of our PDB-style files is described here.)

Timeline for d1yioa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yioa1