SCOPe 2.08: Domain d1yioa2: 1yio A:3-130

Lineage for d1yioa2 (1yio A:3-130)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Response regulatory protein StyR, N-terminal domain [142027] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [142028] (2 PDB entries)
   Uniprot O30989 3-130

8. Domain d1yioa2: 1yio A:3-130 [123327]
   Other proteins in same PDB: d1yioa1
   complexed with hg, mg

Details for d1yioa2

PDB Entry: 1yio, 2.2 Å

PDB Description: Crystallographic structure of response regulator StyR from Pseudomonas fluorescens

PDB Compounds: (A:) response regulatory protein

SCOPe Domain Sequences for d1yioa2:

Sequence; same for both SEQRES and ATOM records:

>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]}
akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhgclvldmrmpgms
gielqeqltaisdgipivfitahgdipmtvramkagaieflpkpfeeqalldaieqglql
naerrqar

Timeline for d1yioa2:

• d1yioa2 first appeared in SCOP 1.73
  
• d1yioa2 appears in SCOPe 2.07