Lineage for d1yijv1 (1yij V:1-65)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904128Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 904129Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 904130Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 904171Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 904182Domain d1yijv1: 1yij V:1-65 [123319]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffks_
    complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijv1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1yijv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1yijv1:

Click to download the PDB-style file with coordinates for d1yijv1.
(The format of our PDB-style files is described here.)

Timeline for d1yijv1: