Lineage for d1yijt1 (1yij T:1-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665510Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 665553Protein Ribosomal proteins L24 (L24p) [50106] (2 species)
  7. 665554Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
  8. 665580Domain d1yijt1: 1yij T:1-119 [123317]
    Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffkq_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijt1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d1yijt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1yijt1:

Click to download the PDB-style file with coordinates for d1yijt1.
(The format of our PDB-style files is described here.)

Timeline for d1yijt1: