Lineage for d1yijs1 (1yij S:1-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716452Family d.12.1.1: L23p [54190] (1 protein)
  6. 716453Protein Ribosomal protein L23 [54191] (2 species)
  7. 716454Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)
  8. 716480Domain d1yijs1: 1yij S:1-81 [123316]
    Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1jj2r_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijs1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1yijs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijs1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1yijs1:

Click to download the PDB-style file with coordinates for d1yijs1.
(The format of our PDB-style files is described here.)

Timeline for d1yijs1: