Lineage for d1yijr1 (1yij R:1-150)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723129Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 723130Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 723131Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 723132Protein Ribosomal protein L22 [54845] (2 species)
  7. 723133Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)
  8. 723159Domain d1yijr1: 1yij R:1-150 [123315]
    Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1ffko_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijr1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1yijr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOP Domain Coordinates for d1yijr1:

Click to download the PDB-style file with coordinates for d1yijr1.
(The format of our PDB-style files is described here.)

Timeline for d1yijr1: