SCOP 1.73: Domain d1yijm1: 1yij M:1-193

Lineage for d1yijm1 (1yij M:1-193)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries)

8. Domain d1yijm1: 1yij M:1-193 [123310]
   Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
   automatically matched to d1s72m_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijm1

PDB Entry: 1yij, 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOP Domain Sequences for d1yijm1:

Sequence; same for both SEQRES and ATOM records:

>d1yijm1 d.12.1.2 (M:1-193) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggk

Timeline for d1yijm1:

• d1yijm1 is new in SCOP 1.73
  
• d1yijm1 appears in SCOP 1.75
  
• d1yijm1 appears in the current release, SCOPe 2.08