Lineage for d1yijk1 (1yij K:1-132)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057998Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2057999Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2058000Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2058001Protein Ribosomal protein L14 [50195] (5 species)
  7. 2058041Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 2058052Domain d1yijk1: 1yij K:1-132 [123308]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1s72k_
    complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijk1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1yijk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1yijk1:

Click to download the PDB-style file with coordinates for d1yijk1.
(The format of our PDB-style files is described here.)

Timeline for d1yijk1: