SCOPe 2.05: Domain d1yijj1: 1yij J:4-145

Lineage for d1yijj1 (1yij J:4-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
   Uniprot P29198

8. Domain d1yijj1: 1yij J:4-145 [123307]
   Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
   automatically matched to d1ffkg_
   complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijj1

PDB Entry: 1yij, 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1yijj1:

Sequence; same for both SEQRES and ATOM records:

>d1yijj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

Timeline for d1yijj1:

• d1yijj1 first appeared in SCOP 1.73
  
• d1yijj1 appears in SCOPe 2.04
  
• d1yijj1 appears in SCOPe 2.06
  
• d1yijj1 appears in the current release, SCOPe 2.08