SCOP 1.73: Domain d1yijf1: 1yij F:1-119

Lineage for d1yijf1 (1yij F:1-119)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)

8. Domain d1yijf1: 1yij F:1-119 [123304]
   Other proteins in same PDB: d1yij11, d1yij31, d1yija1, d1yija2, d1yijb1, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
   automatically matched to d1s72f_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, psu, tel, ur3; mutant

Details for d1yijf1

PDB Entry: 1yij, 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1yijf1:

Sequence; same for both SEQRES and ATOM records:

>d1yijf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d1yijf1:

• d1yijf1 is new in SCOP 1.73
  
• d1yijf1 appears in SCOP 1.75
  
• d1yijf1 appears in the current release, SCOPe 2.08