Lineage for d1yijb1 (1yij B:1-337)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952099Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 952119Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 952274Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 952275Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 952316Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 952328Domain d1yijb1: 1yij B:1-337 [123299]
    Other proteins in same PDB: d1yij11, d1yij21, d1yij31, d1yija1, d1yija2, d1yijc1, d1yijd1, d1yije1, d1yije2, d1yijf1, d1yijg1, d1yijh1, d1yiji1, d1yijj1, d1yijk1, d1yijl1, d1yijm1, d1yijn1, d1yijo1, d1yijp1, d1yijq1, d1yijr1, d1yijs1, d1yijt1, d1yiju1, d1yijv1, d1yijw1, d1yijx1, d1yijy1, d1yijz1
    automatically matched to d1jj2b_
    complexed with cd, cl, k, mg, na, tel; mutant

Details for d1yijb1

PDB Entry: 1yij (more details), 2.6 Å

PDB Description: crystal structure of telithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1yijb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yijb1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1yijb1:

Click to download the PDB-style file with coordinates for d1yijb1.
(The format of our PDB-style files is described here.)

Timeline for d1yijb1: