SCOPe 2.08: Domain d1yiga1: 1yig A:190-255

Lineage for d1yiga1 (1yig A:190-255)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d1yiga1: 1yig A:190-255 [123291]

Details for d1yiga1

PDB Entry: 1yig, 2 Å

PDB Description: crystal structure of the human eb1 c-terminal dimerization domain

PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1yiga1:

Sequence; same for both SEQRES and ATOM records:

>d1yiga1 a.245.1.1 (A:190-255) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrimdilyat
degfvi

Timeline for d1yiga1:

• d1yiga1 first appeared in SCOP 1.73
  
• d1yiga1 appears in SCOPe 2.07