SCOPe 2.04: Domain d1yifd2: 1yif D:2-324

Lineage for d1yifd2 (1yif D:2-324)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families)

5. Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
   automatically mapped to Pfam PF04616

6. Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [141540] (1 PDB entry)
   Uniprot P94489 2-324

8. Domain d1yifd2: 1yif D:2-324 [123290]
   Other proteins in same PDB: d1yifa1, d1yifb1, d1yifc1, d1yifd1
   automated match to d1yifa2

Details for d1yifd2

PDB Entry: 1yif, 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium

PDB Compounds: (D:) beta-1,4-xylosidase

SCOPe Domain Sequences for d1yifd2:

Sequence; same for both SEQRES and ATOM records:

>d1yifd2 b.67.2.1 (D:2-324) Beta-D-xylosidase N-terminal domain {Bacillus subtilis [TaxId: 1423]}
kitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsql
dmkgnpnsggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepikl
nssgfdaslfhdtdgkkyllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtd
rklteaphlyhignyyylltaeggtryehaatiarsaniegpyevhpdnpiltswhdpgn
plqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgretaiqklywkdewp
yvvggkegslevdapsipetife

Timeline for d1yifd2:

• d1yifd2 first appeared in SCOP 1.73
  
• d1yifd2 appears in SCOPe 2.03
  
• d1yifd2 appears in SCOPe 2.05
  
• d1yifd2 appears in the current release, SCOPe 2.08