SCOPe 2.08: Domain d1yifc1: 1yif C:325-533

Lineage for d1yifc1 (1yif C:325-533)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)

6. Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [141163] (1 PDB entry)
   Uniprot P94489 325-533

8. Domain d1yifc1: 1yif C:325-533 [123287]
   Other proteins in same PDB: d1yifa2, d1yifb2, d1yifc2, d1yifd2
   automated match to d1yifa1

Details for d1yifc1

PDB Entry: 1yif, 1.8 Å

PDB Description: crystal structure of beta-1,4-xylosidase from bacillus subtilis, new york structural genomics consortium

PDB Compounds: (C:) beta-1,4-xylosidase

SCOPe Domain Sequences for d1yifc1:

Sequence; same for both SEQRES and ATOM records:

>d1yifc1 b.29.1.23 (C:325-533) Beta-D-xylosidase C-terminal domain {Bacillus subtilis [TaxId: 1423]}
atypevdefedstlninfqtlripftnelgsltqapnhlrlfghesltstftqafvarrw
qslhfeaetavefypenfqqaaglvnyyntenwtalqvthdeelgrilelticdnfsfsq
plnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidialeskklsddyirgggff
tgafvgmqcqdtggnhipadfryfrykek

Timeline for d1yifc1:

• d1yifc1 first appeared in SCOP 1.73
  
• d1yifc1 appears in SCOPe 2.07