![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein) |
![]() | Protein Beta-D-xylosidase C-terminal domain [141162] (4 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141163] (1 PDB entry) Uniprot P94489 325-533 |
![]() | Domain d1yifc1: 1yif C:325-533 [123287] Other proteins in same PDB: d1yifa2, d1yifb2, d1yifc2, d1yifd2 automated match to d1yifa1 |
PDB Entry: 1yif (more details), 1.8 Å
SCOPe Domain Sequences for d1yifc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yifc1 b.29.1.23 (C:325-533) Beta-D-xylosidase C-terminal domain {Bacillus subtilis [TaxId: 1423]} atypevdefedstlninfqtlripftnelgsltqapnhlrlfghesltstftqafvarrw qslhfeaetavefypenfqqaaglvnyyntenwtalqvthdeelgrilelticdnfsfsq plnnkiviprevkyvylrvniekdkyyyfysfnkedwhkidialeskklsddyirgggff tgafvgmqcqdtggnhipadfryfrykek
Timeline for d1yifc1: