![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) ![]() |
![]() | Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins) automatically mapped to Pfam PF04616 |
![]() | Protein Beta-D-xylosidase N-terminal domain [141538] (4 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [141540] (1 PDB entry) Uniprot P94489 2-324 |
![]() | Domain d1yifb2: 1yif B:2-324 [123286] Other proteins in same PDB: d1yifa1, d1yifb1, d1yifc1, d1yifd1 automated match to d1yifa2 |
PDB Entry: 1yif (more details), 1.8 Å
SCOPe Domain Sequences for d1yifb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yifb2 b.67.2.1 (B:2-324) Beta-D-xylosidase N-terminal domain {Bacillus subtilis [TaxId: 1423]} kitnpvlkgfnpdpsicragedyyiavstfewfpgvqihhskdlvnwhlvahplqrvsql dmkgnpnsggvwapclsysdgkfwliytdvkvvdgawkdchnylvtcetingdwsepikl nssgfdaslfhdtdgkkyllnmlwdhridrhsfggiviqeysdkeqkligkpkvifegtd rklteaphlyhignyyylltaeggtryehaatiarsaniegpyevhpdnpiltswhdpgn plqkcghasivqthtdewylahltgrpihpdddsifqqrgycplgretaiqklywkdewp yvvggkegslevdapsipetife
Timeline for d1yifb2: