![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries) Uniprot P68871 |
![]() | Domain d1yied_: 1yie D: [123282] Other proteins in same PDB: d1yiea_, d1yiec_ automated match to d1a01b_ complexed with hem, oxy |
PDB Entry: 1yie (more details), 2.4 Å
SCOPe Domain Sequences for d1yied_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yied_ a.1.1.2 (D:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypatqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1yied_: