Lineage for d1yiba1 (1yib A:190-250)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351135Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2351136Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2351137Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2351138Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2351139Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2351140Domain d1yiba1: 1yib A:190-250 [123278]

Details for d1yiba1

PDB Entry: 1yib (more details), 1.8 Å

PDB Description: Crystal Structure of the Human EB1 C-terminal Dimerization Domain
PDB Compounds: (A:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d1yiba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yiba1 a.245.1.1 (A:190-250) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat
d

SCOPe Domain Coordinates for d1yiba1:

Click to download the PDB-style file with coordinates for d1yiba1.
(The format of our PDB-style files is described here.)

Timeline for d1yiba1: