![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily) dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices |
![]() | Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) ![]() |
![]() | Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein) Pfam PF03271 |
![]() | Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries) |
![]() | Domain d1yiba1: 1yib A:190-250 [123278] mutant |
PDB Entry: 1yib (more details), 1.8 Å
SCOP Domain Sequences for d1yiba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yiba1 a.245.1.1 (A:190-250) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]} ddeaaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat d
Timeline for d1yiba1: