![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.1: PHM/PNGase F [49742] (2 families) ![]() members of this superfamily bind peptide substrates duplication: consists of two domains of this fold packed together like the adjacent nucleoplasmin subunits |
![]() | Family b.121.1.2: Peptidylglycine alpha-hydroxylating monooxygenase, PHM [49746] (1 protein) |
![]() | Protein Peptidylglycine alpha-hydroxylating monooxygenase, PHM [63402] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49748] (26 PDB entries) |
![]() | Domain d1yi9a2: 1yi9 A:199-355 [123277] automated match to d1yi9a2 complexed with cu, gol; mutant |
PDB Entry: 1yi9 (more details), 1.7 Å
SCOPe Domain Sequences for d1yi9a2:
Sequence, based on SEQRES records: (download)
>d1yi9a2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]} pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgegrteathiggtssdeicnly imyymeakyalsfmtctknvapdmfrtipaeanipip
>d1yi9a2 b.121.1.2 (A:199-355) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Norway rat (Rattus norvegicus) [TaxId: 10116]} pliagmylmmsvdtvippgekvvnadiscqykmypmhvfayrvhthhlgkvvsgyrvrng qwtligrqnpqlpqafypvehpvdvtfgdilaarcvftgeeicnlyimyymeakyalsfm tctknvapdmfrtipaeanipip
Timeline for d1yi9a2: