Lineage for d1yi7c1 (1yi7 C:325-534)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664338Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 664339Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 664348Species Clostridium acetobutylicum [TaxId:1488] [141164] (2 PDB entries)
  8. 664355Domain d1yi7c1: 1yi7 C:325-534 [123272]
    Other proteins in same PDB: d1yi7a2, d1yi7b2, d1yi7c2, d1yi7d2
    automatically matched to 1Y7B A:325-534
    complexed with ca, epe, gol, so4

Details for d1yi7c1

PDB Entry: 1yi7 (more details), 1.9 Å

PDB Description: beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum
PDB Compounds: (C:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOP Domain Sequences for d1yi7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi7c1 b.29.1.23 (C:325-534) Beta-D-xylosidase C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
ektydekdnfdsdklninfqslriplteniaslkakkgnlrlygkesltstftqafiarr
wqsfkfdastsvsfspdtfqqaagltcyyntenwstiqvtwnedkgrvidivccdnfhfd
mplksnvipipkdveyihlkvevrvetyqysysfdginwskvpaifesrklsddyvqggg
fftgafvginciditgnnkpadfdyfcyke

SCOP Domain Coordinates for d1yi7c1:

Click to download the PDB-style file with coordinates for d1yi7c1.
(The format of our PDB-style files is described here.)

Timeline for d1yi7c1: