Lineage for d1yi7b2 (1yi7 B:2-324)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553770Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 1553776Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 1553777Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 1553791Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 1553800Species Clostridium acetobutylicum [TaxId:1488] [141542] (2 PDB entries)
    Uniprot Q97DM1 2-322
  8. 1553806Domain d1yi7b2: 1yi7 B:2-324 [123271]
    Other proteins in same PDB: d1yi7a1, d1yi7b1, d1yi7c1, d1yi7d1
    automated match to d1y7ba2
    complexed with ca, epe, gol, so4

Details for d1yi7b2

PDB Entry: 1yi7 (more details), 1.9 Å

PDB Description: beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum
PDB Compounds: (B:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOPe Domain Sequences for d1yi7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi7b2 b.67.2.1 (B:2-324) Beta-D-xylosidase N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
sliknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtsl
ldmkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpit
lngsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgt
dikytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdpr
nslqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnw
prvvggkqgsvnveapkipevkw

SCOPe Domain Coordinates for d1yi7b2:

Click to download the PDB-style file with coordinates for d1yi7b2.
(The format of our PDB-style files is described here.)

Timeline for d1yi7b2: