Lineage for d1yi7b1 (1yi7 B:325-535)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781763Family b.29.1.23: Beta-D-xylosidase C-terminal domain-like [141161] (1 protein)
  6. 1781764Protein Beta-D-xylosidase C-terminal domain [141162] (4 species)
  7. 1781773Species Clostridium acetobutylicum [TaxId:1488] [141164] (2 PDB entries)
    Uniprot Q97DM1 323-532
  8. 1781779Domain d1yi7b1: 1yi7 B:325-535 [123270]
    Other proteins in same PDB: d1yi7a2, d1yi7b2, d1yi7c2, d1yi7d2
    automated match to d1y7ba1
    complexed with ca, epe, gol, so4

Details for d1yi7b1

PDB Entry: 1yi7 (more details), 1.9 Å

PDB Description: beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum
PDB Compounds: (B:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOPe Domain Sequences for d1yi7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi7b1 b.29.1.23 (B:325-535) Beta-D-xylosidase C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
ektydekdnfdsdklninfqslriplteniaslkakkgnlrlygkesltstftqafiarr
wqsfkfdastsvsfspdtfqqaagltcyyntenwstiqvtwnedkgrvidivccdnfhfd
mplksnvipipkdveyihlkvevrvetyqysysfdginwskvpaifesrklsddyvqggg
fftgafvginciditgnnkpadfdyfcykee

SCOPe Domain Coordinates for d1yi7b1:

Click to download the PDB-style file with coordinates for d1yi7b1.
(The format of our PDB-style files is described here.)

Timeline for d1yi7b1: