Lineage for d1yi7a2 (1yi7 A:4-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064808Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 protein domains)
    automatically mapped to Pfam PF04616
  6. 2064822Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2064831Species Clostridium acetobutylicum [TaxId:1488] [141542] (2 PDB entries)
    Uniprot Q97DM1 2-322
  8. 2064836Domain d1yi7a2: 1yi7 A:4-324 [123269]
    Other proteins in same PDB: d1yi7a1, d1yi7a3, d1yi7a4, d1yi7b1, d1yi7b3, d1yi7b4, d1yi7c1, d1yi7c3, d1yi7c4, d1yi7d1, d1yi7d3, d1yi7d4
    automated match to d1y7ba2
    complexed with ca, epe, gol, so4

Details for d1yi7a2

PDB Entry: 1yi7 (more details), 1.9 Å

PDB Description: beta-d-xylosidase (selenomethionine) xynd from clostridium acetobutylicum
PDB Compounds: (A:) Beta-xylosidase, family 43 glycosyl hydrolase

SCOPe Domain Sequences for d1yi7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi7a2 b.67.2.1 (A:4-324) Beta-D-xylosidase N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}
iknpilrgfnpdpsicradtdyyiatstfewfpgvqihhskdlvnwhlvahplnrtslld
mkgnpnsggiwapdlsyhdgkfwliytdvkvtdgmwkdchnylttcesvdgvwsdpitln
gsgfdaslfhdndgkkylvnmywdqrtynhnfygivlqeysdkekkligkakiiykgtdi
kytegphiyhigdyyylftaeggttyehsetvarsknidgpyeidpeyplltswhdprns
lqkcghaslvhthtdewylahlvgrplpvgnqpvleqrgycplgretsiqriewvdnwpr
vvggkqgsvnveapkipevkw

SCOPe Domain Coordinates for d1yi7a2:

Click to download the PDB-style file with coordinates for d1yi7a2.
(The format of our PDB-style files is described here.)

Timeline for d1yi7a2: