SCOPe 2.08: Domain d1yi6a_: 1yi6 A:

Lineage for d1yi6a_ (1yi6 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d1yi6a_: 1yi6 A: [123266]
   automated match to d3bz3a_

Details for d1yi6a_

PDB Entry: 1yi6, 2 Å

PDB Description: C-term tail segment of human tyrosine kinase (258-533)

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1yi6a_:

Sequence; same for both SEQRES and ATOM records:

>d1yi6a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl
rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv
ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg
rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq
cwrkepeerptfeylqafledyftstepqyqpgenl

Timeline for d1yi6a_:

• d1yi6a_ first appeared in SCOP 1.73, called d1yi6a1
  
• d1yi6a_ appears in SCOPe 2.07