![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.1: Snake venom toxins [57303] (28 proteins) automatically mapped to Pfam PF00087 |
![]() | Protein alpha-Cobratoxin [57318] (3 species) |
![]() | Species Cobra (Naja siamensis) [TaxId:84476] [57319] (3 PDB entries) |
![]() | Domain d1yi5i1: 1yi5 I:1-67 [123264] Other proteins in same PDB: d1yi5a1, d1yi5b1, d1yi5c1, d1yi5d1, d1yi5e1 automatically matched to d1ctx__ |
PDB Entry: 1yi5 (more details), 4.2 Å
SCOPe Domain Sequences for d1yi5i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi5i1 g.7.1.1 (I:1-67) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]} ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd ncnpfpt
Timeline for d1yi5i1: