Lineage for d1yi5g1 (1yi5 G:1-68)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032125Protein alpha-Cobratoxin [57318] (3 species)
  7. 3032126Species Cobra (Naja siamensis) [TaxId:84476] [57319] (3 PDB entries)
  8. 3032130Domain d1yi5g1: 1yi5 G:1-68 [123262]
    Other proteins in same PDB: d1yi5a1, d1yi5b1, d1yi5c1, d1yi5d1, d1yi5e1
    automatically matched to d1ctx__

Details for d1yi5g1

PDB Entry: 1yi5 (more details), 4.2 Å

PDB Description: Crystal structure of the a-cobratoxin-AChBP complex
PDB Compounds: (G:) long neurotoxin 1

SCOPe Domain Sequences for d1yi5g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi5g1 g.7.1.1 (G:1-68) alpha-Cobratoxin {Cobra (Naja siamensis) [TaxId: 84476]}
ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
ncnpfptr

SCOPe Domain Coordinates for d1yi5g1:

Click to download the PDB-style file with coordinates for d1yi5g1.
(The format of our PDB-style files is described here.)

Timeline for d1yi5g1: