![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
![]() | Protein Acetylcholine binding protein (ACHBP) [63714] (1 species) |
![]() | Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries) |
![]() | Domain d1yi5d1: 1yi5 D:2-205 [123259] Other proteins in same PDB: d1yi5f1, d1yi5g1, d1yi5h1, d1yi5i1, d1yi5j1 automatically matched to d1uw6a_ |
PDB Entry: 1yi5 (more details), 4.2 Å
SCOPe Domain Sequences for d1yi5d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yi5d1 b.96.1.1 (D:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn svtysccpeayedvevslnfrkkg
Timeline for d1yi5d1: