Lineage for d1yi5b1 (1yi5 B:2-205)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679095Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 679096Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (1 family) (S)
  5. 679097Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (1 protein)
  6. 679098Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 679099Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (5 PDB entries)
  8. 679146Domain d1yi5b1: 1yi5 B:2-205 [123257]
    Other proteins in same PDB: d1yi5f1, d1yi5g1, d1yi5h1, d1yi5i1, d1yi5j1
    automatically matched to d1uw6a_

Details for d1yi5b1

PDB Entry: 1yi5 (more details), 4.2 Å

PDB Description: Crystal structure of the a-cobratoxin-AChBP complex
PDB Compounds: (B:) acetylcholine-binding protein

SCOP Domain Sequences for d1yi5b1:

Sequence, based on SEQRES records: (download)

>d1yi5b1 b.96.1.1 (B:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d1yi5b1 b.96.1.1 (B:2-205) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttnsddseyfsqysrfeildvtqkkns
vtysccpeayedvevslnfrkkg

SCOP Domain Coordinates for d1yi5b1:

Click to download the PDB-style file with coordinates for d1yi5b1.
(The format of our PDB-style files is described here.)

Timeline for d1yi5b1: