Lineage for d1yi2z1 (1yi2 Z:10-82)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966433Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1966434Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
    automatically mapped to Pfam PF01780
  6. 1966435Protein Ribosomal protein L37ae [57831] (1 species)
  7. 1966436Species Haloarcula marismortui [TaxId:2238] [57832] (58 PDB entries)
    Uniprot P60619
  8. 1966448Domain d1yi2z1: 1yi2 Z:10-82 [123255]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1
    automatically matched to d1s72z_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2z1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOPe Domain Sequences for d1yi2z1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2z1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOPe Domain Coordinates for d1yi2z1:

Click to download the PDB-style file with coordinates for d1yi2z1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2z1: