Lineage for d1yi2x1 (1yi2 X:7-88)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858025Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 858026Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 858027Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 858028Protein Ribosomal protein L31e [54577] (1 species)
  7. 858029Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 858040Domain d1yi2x1: 1yi2 X:7-88 [123253]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2y1, d1yi2z1
    automatically matched to d1ffku_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2x1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1yi2x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1yi2x1:

Click to download the PDB-style file with coordinates for d1yi2x1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2x1: