Lineage for d1yi2w1 (1yi2 W:1-154)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1030518Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1030519Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1030520Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1030521Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1030522Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1030534Domain d1yi2w1: 1yi2 W:1-154 [123252]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffkt_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2w1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1yi2w1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1yi2w1:

Click to download the PDB-style file with coordinates for d1yi2w1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2w1: