Lineage for d1yi2v1 (1yi2 V:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760101Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 760102Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 760103Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 760104Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 760115Domain d1yi2v1: 1yi2 V:1-65 [123251]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffks_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2v1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1yi2v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1yi2v1:

Click to download the PDB-style file with coordinates for d1yi2v1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2v1: