Lineage for d1yi2u1 (1yi2 U:4-56)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065697Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 1065698Protein Ribosomal protein L24e [57750] (1 species)
  7. 1065699Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 1065711Domain d1yi2u1: 1yi2 U:4-56 [123250]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffkr_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2u1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1yi2u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2u1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1yi2u1:

Click to download the PDB-style file with coordinates for d1yi2u1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2u1: