Lineage for d1yi2q1 (1yi2 Q:1-95)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665510Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 665511Protein Ribosomal proteins L21e [50108] (1 species)
  7. 665512Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
  8. 665519Domain d1yi2q1: 1yi2 Q:1-95 [123246]
    Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1ffkn_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2q1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOP Domain Sequences for d1yi2q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2q1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Archaeon Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1yi2q1:

Click to download the PDB-style file with coordinates for d1yi2q1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2q1: