SCOP 1.73: Domain d1yi2m1: 1yi2 M:1-193

Lineage for d1yi2m1 (1yi2 M:1-193)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (40 PDB entries)

8. Domain d1yi2m1: 1yi2 M:1-193 [123242]
   Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
   automatically matched to d1s72m_
   complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2m1

PDB Entry: 1yi2, 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOP Domain Sequences for d1yi2m1:

Sequence; same for both SEQRES and ATOM records:

>d1yi2m1 d.12.1.2 (M:1-193) Ribosomal protein L15e {Archaeon Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggk

Timeline for d1yi2m1:

• d1yi2m1 is new in SCOP 1.73
  
• d1yi2m1 appears in SCOP 1.75
  
• d1yi2m1 appears in the current release, SCOPe 2.08