SCOPe 2.05: Domain d1yi2k1: 1yi2 K:1-132

Lineage for d1yi2k1 (1yi2 K:1-132)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)
   automatically mapped to Pfam PF00238

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
   Uniprot P22450

8. Domain d1yi2k1: 1yi2 K:1-132 [123240]
   Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
   automatically matched to d1s72k_
   complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2k1

PDB Entry: 1yi2, 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1yi2k1:

Sequence; same for both SEQRES and ATOM records:

>d1yi2k1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1yi2k1:

• d1yi2k1 first appeared in SCOP 1.73
  
• d1yi2k1 appears in SCOPe 2.04
  
• d1yi2k1 appears in SCOPe 2.06
  
• d1yi2k1 appears in the current release, SCOPe 2.08