Lineage for d1yi2i1 (1yi2 I:66-135)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636030Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 636031Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 636032Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)
  7. 636033Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (22 PDB entries)
  8. 636038Domain d1yi2i1: 1yi2 I:66-135 [123238]
    Other proteins in same PDB: d1yi211, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2h1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1s72i_
    complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2i1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d1yi2i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2i1 a.4.7.1 (I:66-135) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOP Domain Coordinates for d1yi2i1:

Click to download the PDB-style file with coordinates for d1yi2i1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2i1: