Lineage for d1yi2h1 (1yi2 H:4-166)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189212Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2189213Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 2189214Protein Ribosomal protein L10e [54688] (2 species)
  7. 2189215Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries)
    Uniprot P60617
  8. 2189227Domain d1yi2h1: 1yi2 H:4-166 [123237]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2f1, d1yi2g1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1s72h_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2h1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOPe Domain Sequences for d1yi2h1:

Sequence, based on SEQRES records: (download)

>d1yi2h1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1yi2h1 d.41.4.1 (H:4-166) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOPe Domain Coordinates for d1yi2h1:

Click to download the PDB-style file with coordinates for d1yi2h1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2h1: