Lineage for d1yi2f1 (1yi2 F:1-119)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914577Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1914594Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1914602Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 1914614Domain d1yi2f1: 1yi2 F:1-119 [123236]
    Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2e1, d1yi2e2, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
    automatically matched to d1s72f_
    complexed with cd, cl, ery, k, mg, na; mutant

Details for d1yi2f1

PDB Entry: 1yi2 (more details), 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1yi2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yi2f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d1yi2f1:

Click to download the PDB-style file with coordinates for d1yi2f1.
(The format of our PDB-style files is described here.)

Timeline for d1yi2f1: