SCOP 1.75: Domain d1yi2e2: 1yi2 E:80-172

Lineage for d1yi2e2 (1yi2 E:80-172)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
   Uniprot P14135

8. Domain d1yi2e2: 1yi2 E:80-172 [123235]
   Other proteins in same PDB: d1yi211, d1yi221, d1yi231, d1yi2a1, d1yi2a2, d1yi2b1, d1yi2c1, d1yi2d1, d1yi2f1, d1yi2g1, d1yi2h1, d1yi2i1, d1yi2j1, d1yi2k1, d1yi2l1, d1yi2m1, d1yi2n1, d1yi2o1, d1yi2p1, d1yi2q1, d1yi2r1, d1yi2s1, d1yi2t1, d1yi2u1, d1yi2v1, d1yi2w1, d1yi2x1, d1yi2y1, d1yi2z1
   automatically matched to d1ffk12
   complexed with 1ma, cd, cl, ery, k, mg, na, omg, omu, psu, ur3; mutant

Details for d1yi2e2

PDB Entry: 1yi2, 2.65 Å

PDB Description: crystal structure of erythromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1yi2e2:

Sequence; same for both SEQRES and ATOM records:

>d1yi2e2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1yi2e2:

• d1yi2e2 first appeared in SCOP 1.73
  
• d1yi2e2 appears in SCOPe 2.01
  
• d1yi2e2 appears in the current release, SCOPe 2.08